Viridis Quo
Up and coming lifestyle clothing brand. LA based. Striving to live impact-free and GREEN. Heavy on HEMP and its legalization and expansion. Art. Music. Earth.
Gettin those amino acids 💪 that good fat shit 🍩 some phytonutrients 🌰 haha yeah, #imanerd. my #hempweek #dinner pt. 1.. #hemp #hempseed #hempoil #salad #protein #aminos #goodfatshit #avo #omegas #balanced #brainfood #healthy #fit #foodporn #hempporn? #clean #green #viridisquo #veganfoodboner #herbivore #ieatearth #plantlife #hemphistoryweek @nutiva
  1. Gettin those amino acids 💪 that good fat shit 🍩 some phytonutrients 🌰 haha yeah, #imanerd. my #hempweek #dinner pt. 1.. #hemp #hempseed #hempoil #salad #protein #aminos #goodfatshit #avo #omegas #balanced #brainfood #healthy #fit #foodporn #hempporn? #clean #green #viridisquo #veganfoodboner #herbivore #ieatearth #plantlife #hemphistoryweek @nutiva

  1. Timestamp: Tuesday 2013/06/04 23:54:42imanerdhempoilplantlifehemphistoryweekhempseedavobalancedproteinherbivorefitviridisquoomegasveganfoodbonergoodfatshitfoodpornbrainfoodieatearthhempaminoshemppornsaladhealthyhempweekdinnergreenclean